Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTPN1 protein

This Human PTPN1 protein spans the amino acid sequence from region 1-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein-tyrosine phosphatase 1B (PTP-1B) (PTP1B)

UniProt

P18031

Expression Region

1-321aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HE4/WFDC2 Antibody Picoband® (FITC Conjugate)
A02685-4-FITC 100 µg/Vial

Anti-HE4/WFDC2 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
SMAD1 (SMAD Family Member 1, BSP1, JV4-1, JV41, MADH1, MADR1) (MaxLight 750)
MBS6240585-01 0.1 mL

SMAD1 (SMAD Family Member 1, BSP1, JV4-1, JV41, MADH1, MADR1) (MaxLight 750)

Sign In for Pricing
View Details
SMAD1 (SMAD Family Member 1, BSP1, JV4-1, JV41, MADH1, MADR1) (MaxLight 750)
MBS6240585-02 5x 0.1 mL

SMAD1 (SMAD Family Member 1, BSP1, JV4-1, JV41, MADH1, MADR1) (MaxLight 750)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2142071-01 0.1 mL

FITC-Linked Polyclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2142071-02 0.2 mL

FITC-Linked Polyclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to 5-Lipoxygenase (5-LO)
MBS2142071-03 0.5 mL

FITC-Linked Polyclonal Antibody to 5-Lipoxygenase (5-LO)

Sign In for Pricing
View Details