Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Prkn protein

This Mouse Prkn protein spans the amino acid sequence from region 1-464aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parkin RBR E3 ubiquitin-protein ligase (Park2)

UniProt

Q9WVS6

Expression Region

1-464aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

79.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mesothelin Antibody, mAb, Rabbit
A04536-50 50 µL

Mesothelin Antibody, mAb, Rabbit

Sign In for Pricing
View Details
MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (MaxLight 550)
129913-ML550 100 µL

MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (MaxLight 550)

Sign In for Pricing
View Details
(1S,4R) -N-Desmethyl sertraline hydrochloride
271704-01 1 mg

(1S,4R) -N-Desmethyl sertraline hydrochloride

Sign In for Pricing
View Details
(1S,4R) -N-Desmethyl sertraline hydrochloride
271704-02 2 mg

(1S,4R) -N-Desmethyl sertraline hydrochloride

Sign In for Pricing
View Details
(1S,4R) -N-Desmethyl sertraline hydrochloride
271704-03 5 mg

(1S,4R) -N-Desmethyl sertraline hydrochloride

Sign In for Pricing
View Details
(1S,4R) -N-Desmethyl sertraline hydrochloride
271704-04 10 mg

(1S,4R) -N-Desmethyl sertraline hydrochloride

Sign In for Pricing
View Details