Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FMR1NB protein

This Human FMR1NB protein spans the amino acid sequence from region 90-183aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 37 (CT37) (Sarcoma antigen NY-SAR-35)

UniProt

Q8N0W7

Expression Region

90-183aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), Biotin conjugate, 0.1mg/mL
BNCB1540-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LOC100129484 activation kit by CRISPRa
GA119098 1 Kit

Human LOC100129484 activation kit by CRISPRa

Sign In for Pricing
View Details
Dylight 649 Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-
DY649-1802-1 1 mg

Dylight 649 Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-

Sign In for Pricing
View Details
Recombinant Rb (phospho S780) Antibody
RC-5590-01 50 μL

Recombinant Rb (phospho S780) Antibody

Sign In for Pricing
View Details
Recombinant Rb (phospho S780) Antibody
RC-5590-02 100 µL

Recombinant Rb (phospho S780) Antibody

Sign In for Pricing
View Details
Recombinant Rb (phospho S780) Antibody
RC-5590-03 1 mL

Recombinant Rb (phospho S780) Antibody

Sign In for Pricing
View Details