Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FMR1NB protein

This Human FMR1NB protein spans the amino acid sequence from region 90-183aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 37 (CT37) (Sarcoma antigen NY-SAR-35)

UniProt

Q8N0W7

Expression Region

90-183aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 4 (ITGB4) (1619-1822) Mouse Monoclonal Antibody [Clone ID: 10B10D5]
AM33173SU-N 100 µL

Integrin beta 4 (ITGB4) (1619-1822) Mouse Monoclonal Antibody [Clone ID: 10B10D5]

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-100 1x 100 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Camp Mouse Gene Knockout Kit (CRISPR)
KN502489 1 Kit

Camp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gasdermin D (N terminal) Recombinant Rabbit monoclonal Antibody
HA750486 100 µL

Gasdermin D (N terminal) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TDP43 (TARDBP) Mouse Monoclonal Antibody [Clone ID: k1B8]
AM09038PU-S 50 µL

TDP43 (TARDBP) Mouse Monoclonal Antibody [Clone ID: k1B8]

Sign In for Pricing
View Details
Snhg11 Mouse Gene Knockout Kit (CRISPR)
KN516388 1 Kit

Snhg11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details