Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FMR1NB protein

This Human FMR1NB protein spans the amino acid sequence from region 90-183aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 37 (CT37) (Sarcoma antigen NY-SAR-35)

UniProt

Q8N0W7

Expression Region

90-183aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Endometrium
CR561119 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
CDON Human Gene Knockout Kit (CRISPR)
KN214134LP 1 Kit

CDON Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-Rat IgG2a Antibody
KC-521-01 50 μL

Anti-Rat IgG2a Antibody

Sign In for Pricing
View Details
Anti-Rat IgG2a Antibody
KC-521-02 100 µL

Anti-Rat IgG2a Antibody

Sign In for Pricing
View Details
Anti-Rat IgG2a Antibody
KC-521-03 1 mL

Anti-Rat IgG2a Antibody

Sign In for Pricing
View Details
WNT5A Human Gene Knockout Kit (CRISPR)
KN209206LP 1 Kit

WNT5A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details