Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FMR1NB protein

This Human FMR1NB protein spans the amino acid sequence from region 90-183aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 37 (CT37) (Sarcoma antigen NY-SAR-35)

UniProt

Q8N0W7

Expression Region

90-183aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM13C Rabbit Polyclonal Antibody
HA500274 100 µL

FAM13C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMC1 (SMC1A) (NM_006306) Human Over-expression Lysate
LC401901 20 µg

SMC1 (SMC1A) (NM_006306) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Anti-Mouse PD-1 (29F.1A12) Recombinant Antibody
ICH1211-10mg 10 mg (2x 5 mg)

Mouse Anti-Mouse PD-1 (29F.1A12) Recombinant Antibody

Sign In for Pricing
View Details
Fmoc-Ala TentaGel® S PHB Resin
SA1301.25G 25 g

Fmoc-Ala TentaGel® S PHB Resin

Sign In for Pricing
View Details
Bisphenol F
TRC-B519555-25G 25 g

Bisphenol F

Sign In for Pricing
View Details
EASYStep Pro Rabbit Cortisol (Cor) ELISA Kit
RDEp-Cor-Rb 96 Tests

EASYStep Pro Rabbit Cortisol (Cor) ELISA Kit

Sign In for Pricing
View Details