Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Hypoderma lineatum Hypodermin-B protein

This Plant Hypoderma lineatum Hypodermin-B protein spans the amino acid sequence from region 1-191aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNase MC

UniProt

P23540

Expression Region

1-191aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Momordica charantia (Bitter gourd) (Balsam pear)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FDSFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQGSGTSLTNCPQGSPFDITKISHLQSQLNTLWPNVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPHAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVQVVACFAQDGSTLIDCTRDTCGANFIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAB1, ID (Disabled Homolog 1, DAB1) (APC)
MBS6471834-01 0.2 mL

DAB1, ID (Disabled Homolog 1, DAB1) (APC)

Sign In for Pricing
View Details
DAB1, ID (Disabled Homolog 1, DAB1) (APC)
MBS6471834-02 5x 0.2 mL

DAB1, ID (Disabled Homolog 1, DAB1) (APC)

Sign In for Pricing
View Details
IGFBP2 Mouse mAb
orb2717576-01 50 µL

IGFBP2 Mouse mAb

Sign In for Pricing
View Details
IGFBP2 Mouse mAb
orb2717576-02 100 µL

IGFBP2 Mouse mAb

Sign In for Pricing
View Details
OPRM1 Antibody
orb2678810-01 50 µL

OPRM1 Antibody

Sign In for Pricing
View Details
OPRM1 Antibody
orb2678810-02 100 µL

OPRM1 Antibody

Sign In for Pricing
View Details