Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Hypoderma lineatum Hypodermin-B protein

This Plant Hypoderma lineatum Hypodermin-B protein spans the amino acid sequence from region 1-191aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNase MC

UniProt

P23540

Expression Region

1-191aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Momordica charantia (Bitter gourd) (Balsam pear)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FDSFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQGSGTSLTNCPQGSPFDITKISHLQSQLNTLWPNVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPHAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVQVVACFAQDGSTLIDCTRDTCGANFIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sclerostin Rabbit Polyclonal Antibody
orb783299-01 50 μL

Sclerostin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sclerostin Rabbit Polyclonal Antibody
orb783299-02 100 µL

Sclerostin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sclerostin Rabbit Polyclonal Antibody
orb783299-03 200 µL

Sclerostin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Immunoglobulin-Like Transcript 4 (ILT4, CD85d)
397316 100 µg

Immunoglobulin-Like Transcript 4 (ILT4, CD85d)

Sign In for Pricing
View Details
CISD1 Rabbit Polyclonal Antibody (BF680)
orb2519569 100 µL

CISD1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
hsa-miR-6770-5p miRNA Inhibitor
MIH03500 2x 5.0 nmol

hsa-miR-6770-5p miRNA Inhibitor

Sign In for Pricing
View Details