Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TSPAN2 protein

This Human TSPAN2 protein spans the amino acid sequence from region 112-188aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tspan-2 (Tetraspan NET-3)

UniProt

O60636

Expression Region

112-188aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP9 Rabbit Polyclonal Antibody (Fluoro550)
orb3129073 100 µg

RP9 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
LOC100361928 3'UTR Luciferase Stable Cell Line
TU208154 1.0 mL

LOC100361928 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Methyl 2- (pyridin-3-yl) propanoate
EGA36912-01 50 mg

Methyl 2- (pyridin-3-yl) propanoate

Sign In for Pricing
View Details
Methyl 2- (pyridin-3-yl) propanoate
EGA36912-02 0.5 g

Methyl 2- (pyridin-3-yl) propanoate

Sign In for Pricing
View Details
Lentiviral mouse Tbca shRNA (UAS) - Lentiviral mouse Tbca shRNA (UAS) (100)
GTR15146910 1 Vial

Lentiviral mouse Tbca shRNA (UAS) - Lentiviral mouse Tbca shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Arginine deiminase (arcA)
MBS1395824-01 0.02 mg (E-Coli)

Recombinant Burkholderia mallei Arginine deiminase (arcA)

Sign In for Pricing
View Details