Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria acpS protein

This Bacteria acpS protein spans the amino acid sequence from region 1-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Holo-ACP synthase (4'-phosphopantetheinyl transferase AcpS)

UniProt

A9NHV3

Expression Region

1-118aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Acholeplasma laidlawii (strain PG-8A)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A7 Protein Vector (Human) (pPM-C-HA)
PV026855 500 ng

MS4A7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MLK2/MAP3K10 Rabbit Polyclonal Antibody (BF647)
orb2474668 100 µL

MLK2/MAP3K10 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Lentiviral human BHLHB9 shRNA (UAS) - Lentiviral human BHLHB9 shRNA (UAS, iRFP) (100)
GTR15089595 1 Vial

Lentiviral human BHLHB9 shRNA (UAS) - Lentiviral human BHLHB9 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
NUDC Polyclonal Antibody
MBS2534891-01 0.02 mL

NUDC Polyclonal Antibody

Sign In for Pricing
View Details
NUDC Polyclonal Antibody
MBS2534891-02 0.06 mL

NUDC Polyclonal Antibody

Sign In for Pricing
View Details
NUDC Polyclonal Antibody
MBS2534891-03 0.12 mL

NUDC Polyclonal Antibody

Sign In for Pricing
View Details