Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRY1 protein

This Human CRY1 protein spans the amino acid sequence from region 1-586aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PHLL1

UniProt

Q16526

Expression Region

1-586aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF334 antibody
70R-9581 100 µL

ZNF334 antibody

Sign In for Pricing
View Details
Lentiviral mouse Agap1 shRNA (UAS) - Lentiviral mouse Agap1 shRNA (UAS, RFP) plasmid
GTR15195289 1 Vial

Lentiviral mouse Agap1 shRNA (UAS) - Lentiviral mouse Agap1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
MED19 Polyclonal Conjugated Antibody
C30207 100 µL

MED19 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
HSP90beta Monoclonal Antibody (M2)
MBS9241472-01 0.1 mL

HSP90beta Monoclonal Antibody (M2)

Sign In for Pricing
View Details
HSP90beta Monoclonal Antibody (M2)
MBS9241472-02 5x 0.1 mL

HSP90beta Monoclonal Antibody (M2)

Sign In for Pricing
View Details
5-HT2 agonist-1 free base
T79805-01 5 mg

5-HT2 agonist-1 free base

Sign In for Pricing
View Details