Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria yopB protein

This Bacteria yopB protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YopB, Protein YopB

UniProt

P37131

Expression Region

1-165aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Yersinia enterocolitica

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSALITHDRSTPVTGSLVPYIETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGMASK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1287 Mouse qPCR Primer Pair (NM_001011773)
MP209505 200 Reactions

Olfr1287 Mouse qPCR Primer Pair (NM_001011773)

Sign In for Pricing
View Details
Csn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3255705 3x 1.0 µg

Csn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RLN2 Adenovirus (Human)
39629051 1.0 mL

RLN2 Adenovirus (Human)

Sign In for Pricing
View Details
Rat Tumor Necrosis Factor Alpha (TNFa) CLIA Kit
EKU08844 96 Tests

Rat Tumor Necrosis Factor Alpha (TNFa) CLIA Kit

Sign In for Pricing
View Details
RGD1565149 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6229807 1.0 µg DNA

RGD1565149 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PDK4-IN-1 hydrochloride
MBS5767310 Inquire

PDK4-IN-1 hydrochloride

Sign In for Pricing
View Details