Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria yopB protein

This Bacteria yopB protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YopB, Protein YopB

UniProt

P37131

Expression Region

1-165aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Yersinia enterocolitica

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSALITHDRSTPVTGSLVPYIETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGMASK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUS CRISPR All-in-one AAV vector set (with saCas9)(Rat)
21072156 3x 1.0 µg DNA

FUS CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Cenpe AAV siRNA Pooled Vector
15873164 1.0 µg

Cenpe AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody, FITC Conjugated
A59860-050 50 µL

MRPL22 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Vibrio splendidus Prolipoprotein diacylglyceryl transferase (lgt)
orb2907577-01 20 µg

Recombinant Vibrio splendidus Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Vibrio splendidus Prolipoprotein diacylglyceryl transferase (lgt)
orb2907577-02 100 µg

Recombinant Vibrio splendidus Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
PLV3-U6-METTL27 (human) -shRNA2-Puro
BZ56749 1 Vial

PLV3-U6-METTL27 (human) -shRNA2-Puro

Sign In for Pricing
View Details