Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria yopB protein

This Bacteria yopB protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YopB, Protein YopB

UniProt

P37131

Expression Region

1-165aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Yersinia enterocolitica

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSALITHDRSTPVTGSLVPYIETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGMASK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MCAM/CD146 Antibody (MCAM/1101) - Azide and BSA Free
NBP2-47776-0.1mg 0.1 mg

Mouse Monoclonal MCAM/CD146 Antibody (MCAM/1101) - Azide and BSA Free

Sign In for Pricing
View Details
KCTD14 Protein Vector (Human) (pPB-N-His)
PV022254 500 ng

KCTD14 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PTPRD Rabbit Polyclonal Antibody
TA380544 100 µL

PTPRD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CYP3A5 antibody
STJ29976 100 µl

Anti-CYP3A5 antibody

Sign In for Pricing
View Details
Lentiviral mouse Nfatc1 shRNA (UAS) - Lentiviral mouse Nfatc1 shRNA (UAS, iRFP) plasmid
GTR15304243 1 Vial

Lentiviral mouse Nfatc1 shRNA (UAS) - Lentiviral mouse Nfatc1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human Hemoglobin (Hb) ELISA Kit
MBS9424562-01 96 Tests

Human Hemoglobin (Hb) ELISA Kit

Sign In for Pricing
View Details