Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Echs1 protein

This Mouse Echs1 protein spans the amino acid sequence from region 28-290aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)

UniProt

Q8BH95

Expression Region

28-290aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Palatinose hydrate
orb1302490-01 1 ml x 10 mM (in DMSO)

Palatinose hydrate

Sign In for Pricing
View Details
Palatinose hydrate
orb1302490-02 5 g

Palatinose hydrate

Sign In for Pricing
View Details
AdmiRa-hsa-mir-4456 Virus
mh1237 250 µL

AdmiRa-hsa-mir-4456 Virus

Sign In for Pricing
View Details
Hepatitis A virus polyprotein VP1 Rabbit Polyclonal Antibody (HRP)
orb2550892 100 µL

Hepatitis A virus polyprotein VP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rat Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit
orb1664205-01 48 Tests

Rat Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit

Sign In for Pricing
View Details
Rat Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit
orb1664205-02 96 Tests

Rat Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit

Sign In for Pricing
View Details