Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Echs1 protein

This Mouse Echs1 protein spans the amino acid sequence from region 28-290aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)

UniProt

Q8BH95

Expression Region

28-290aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ROCK1 Antibody Picoband®, APC Conjugate
A00722-5-APC 100 µg/Vial

Anti-ROCK1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
PIC 365-400*200-B7525 AC Signs
255424 Card of 1 Pictogram(s)

PIC 365-400*200-B7525 AC Signs

Sign In for Pricing
View Details
MagLab, Magnestic Boxes Type
1217021 4 PK

MagLab, Magnestic Boxes Type

Sign In for Pricing
View Details
Phospho-CDKN1B (Thr187) Rabbit Polyclonal Antibody (BF488)
orb1588148 100 µL

Phospho-CDKN1B (Thr187) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
SDCCAG1/NEMF Rabbit Polyclonal Antibody
orb1743891 100 µg

SDCCAG1/NEMF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human NKG2-D/KLRK1/CD314 Protein
MBS9146820-01 0.01 mg

Recombinant Human NKG2-D/KLRK1/CD314 Protein

Sign In for Pricing
View Details