Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TSPAN2 protein

This Human TSPAN2 protein spans the amino acid sequence from region 112-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TSPAN2Tetraspanin-2, Tspan-2, Tetraspan NET-3

UniProt

O60636

Expression Region

112-188aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ac-His-NHMe
4017306.0250 250 mg

Ac-His-NHMe

Sign In for Pricing
View Details
Macrophage Migration Inhibitory Factor, Recombinant, Human, aa2-115, His-Tag, Myc-Tag
585274-01 20 µg

Macrophage Migration Inhibitory Factor, Recombinant, Human, aa2-115, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Macrophage Migration Inhibitory Factor, Recombinant, Human, aa2-115, His-Tag, Myc-Tag
585274-02 100 µg

Macrophage Migration Inhibitory Factor, Recombinant, Human, aa2-115, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Os05g0477200 protein Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2556223 100 µL

Os05g0477200 protein Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
FAM83F Rabbit Polyclonal Antibody
orb3070998-01 30 µL

FAM83F Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM83F Rabbit Polyclonal Antibody
orb3070998-02 50 µL

FAM83F Rabbit Polyclonal Antibody

Sign In for Pricing
View Details