Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine MTPN protein

This Bovine MTPN protein spans the amino acid sequence from region 2-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MTPN, Myotrophin

UniProt

Q3T0F7

Expression Region

2-118aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat PGR (Progesterone Receptor) CLIA Kit
E-CL-R0549-01 24 Tests

Rat PGR (Progesterone Receptor) CLIA Kit

Sign In for Pricing
View Details
Rat PGR (Progesterone Receptor) CLIA Kit
E-CL-R0549-02 48 Tests

Rat PGR (Progesterone Receptor) CLIA Kit

Sign In for Pricing
View Details
Rat PGR (Progesterone Receptor) CLIA Kit
E-CL-R0549-03 96 Tests

Rat PGR (Progesterone Receptor) CLIA Kit

Sign In for Pricing
View Details
SLA CLASS II DR Mouse Monoclonal Antibody [Clone ID: 2E9/13]
AM05887PU-S 100 µg

SLA CLASS II DR Mouse Monoclonal Antibody [Clone ID: 2E9/13]

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF647 conjugate, 0.1mg/mL
BNC471118-500 1x 500 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp345 Mouse Gene Knockout Kit (CRISPR)
KN519794 1 Kit

Zfp345 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details