Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine MTPN protein

This Bovine MTPN protein spans the amino acid sequence from region 2-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MTPN, Myotrophin

UniProt

Q3T0F7

Expression Region

2-118aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbmx Mouse Gene Knockout Kit (CRISPR)
KN514586 1 Kit

Rbmx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS507761 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Rpl39 (NM_026055) Mouse Tagged ORF Clone
MG200015 10 µg

Rpl39 (NM_026055) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Transferrin Antibody
KC-2176-01 50 μL

Transferrin Antibody

Sign In for Pricing
View Details
Transferrin Antibody
KC-2176-02 100 µL

Transferrin Antibody

Sign In for Pricing
View Details
Transferrin Antibody
KC-2176-03 1 mL

Transferrin Antibody

Sign In for Pricing
View Details