Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ISCU protein

This Human ISCU protein spans the amino acid sequence from region 35-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)

UniProt

Q9H1K1

Expression Region

35-167aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Codonopsis Pilosula Extract
E3141-25mg 25 mg

Codonopsis Pilosula Extract

Sign In for Pricing
View Details
AmCyan discontinued
347347-01 100 µL

AmCyan discontinued

Sign In for Pricing
View Details
AmCyan discontinued
347347-02 200 µL

AmCyan discontinued

Sign In for Pricing
View Details
Lentiviral mouse Prkab2 shRNA (UAS) - Lentiviral mouse Prkab2 shRNA (UAS) (100)
GTR15292062 1 Vial

Lentiviral mouse Prkab2 shRNA (UAS) - Lentiviral mouse Prkab2 shRNA (UAS) (100)

Sign In for Pricing
View Details
BAY 87-2243
C12592-1g 1 g

BAY 87-2243

Sign In for Pricing
View Details
Human Inhibin ELISA Kit
MBS728353-01 48 Well

Human Inhibin ELISA Kit

Sign In for Pricing
View Details