Human ISCU protein
This Human ISCU protein spans the amino acid sequence from region 35-167aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)
UniProt
Q9H1K1
Expression Region
35-167aa
Tag
N-terminal 6xHis-sumostar-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2805364-01 48 Tests
Human ATP-binding cassette sub-family G member 4 (ABCG4) ELISA Kit
Sign In for Pricing
View Details MBS2805364-02 96 Tests
Human ATP-binding cassette sub-family G member 4 (ABCG4) ELISA Kit
Sign In for Pricing
View Details MBS2805364-03 5x 96 Tests
Human ATP-binding cassette sub-family G member 4 (ABCG4) ELISA Kit
Sign In for Pricing
View Details MBS2805364-04 10x 96 Tests
Human ATP-binding cassette sub-family G member 4 (ABCG4) ELISA Kit
Sign In for Pricing
View Details 