Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ISCU protein

This Human ISCU protein spans the amino acid sequence from region 35-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)

UniProt

Q9H1K1

Expression Region

35-167aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Na(+)/H (+) antiporter subunit E1
MBS7020486-01 0.02 mg

Recombinant Staphylococcus aureus Na(+)/H (+) antiporter subunit E1

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Na(+)/H (+) antiporter subunit E1
MBS7020486-02 0.1 mg

Recombinant Staphylococcus aureus Na(+)/H (+) antiporter subunit E1

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Na(+)/H (+) antiporter subunit E1
MBS7020486-03 5x 0.1 mg

Recombinant Staphylococcus aureus Na(+)/H (+) antiporter subunit E1

Sign In for Pricing
View Details
Tissue type plasminogen activator (T-PA) Human ELISA Kit (1) 1
90076 96 Tests

Tissue type plasminogen activator (T-PA) Human ELISA Kit (1) 1

Sign In for Pricing
View Details
HEATR7A Rabbit pAb, BF700 conjugated
orb2841979 100 µL

HEATR7A Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
LANCL2 (LanC-like Protein 2, Testis-specific Adriamycin Sensitivity Protein, GPR69B, TASP, MGC87139)
MBS642868-01 0.05 mg

LANCL2 (LanC-like Protein 2, Testis-specific Adriamycin Sensitivity Protein, GPR69B, TASP, MGC87139)

Sign In for Pricing
View Details