Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PAX5 protein

This Human PAX5 protein spans the amino acid sequence from region 1-391aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell-specific transcription factor (BSAP)

UniProt

Q02548

Expression Region

1-391aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iodoethane-1,1-d2 (Stabilized with Copper)
TRC-I705874-500MG 500 mg

Iodoethane-1,1-d2 (Stabilized with Copper)

Sign In for Pricing
View Details
Human TMEM65 activation kit by CRISPRa
GA115920 1 Kit

Human TMEM65 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS631494 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Mouse TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit
E-EL-M3112-01 24 Tests

Mouse TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit

Sign In for Pricing
View Details
Mouse TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit
E-EL-M3112-02 48 Tests

Mouse TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit

Sign In for Pricing
View Details
Mouse TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit
E-EL-M3112-03 96 Tests

Mouse TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit

Sign In for Pricing
View Details