Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YJEFN3 protein

This Human YJEFN3 protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YjeF_N3 (hYjeF_N3)

UniProt

A6XGL0

Expression Region

1-299aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOE1 (Target of EGR1 Protein 1, FLJ13949) (MaxLight 550)
MBS6396881-01 0.1 mL

TOE1 (Target of EGR1 Protein 1, FLJ13949) (MaxLight 550)

Sign In for Pricing
View Details
TOE1 (Target of EGR1 Protein 1, FLJ13949) (MaxLight 550)
MBS6396881-02 5x 0.1 mL

TOE1 (Target of EGR1 Protein 1, FLJ13949) (MaxLight 550)

Sign In for Pricing
View Details
CXCR6 Rabbit pAb
orb2715978-01 50 µL

CXCR6 Rabbit pAb

Sign In for Pricing
View Details
CXCR6 Rabbit pAb
orb2715978-02 100 µL

CXCR6 Rabbit pAb

Sign In for Pricing
View Details
ACSL1 Knockout HT29 Polyclonal Cells
ARG32843 1 Million

ACSL1 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Anti-MCM2 Antibody
CPA9777-01 30 µL

Anti-MCM2 Antibody

Sign In for Pricing
View Details