Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRBC1 protein

This Human TRBC1 protein spans the amino acid sequence from region 1-129aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TRBC1, T cell receptor beta constant 1

UniProt

P01850

Expression Region

1-129aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC14 Protein Vector (Rat) (pPM-C-His)
PV264453 500 ng

DNAJC14 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Bumetanide β-D-Glucuronide Allyl Ester
443576-01 1 mg

Bumetanide β-D-Glucuronide Allyl Ester

Sign In for Pricing
View Details
Bumetanide β-D-Glucuronide Allyl Ester
443576-02 5 mg

Bumetanide β-D-Glucuronide Allyl Ester

Sign In for Pricing
View Details
SPARC Rabbit Polyclonal Antibody (HRP)
orb469867 100 µL

SPARC Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
UBE2F polyclonal antibody
BS70670-01 50 µL

UBE2F polyclonal antibody

Sign In for Pricing
View Details
UBE2F polyclonal antibody
BS70670-02 100 µL

UBE2F polyclonal antibody

Sign In for Pricing
View Details