Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL20RB protein

This Human IL20RB protein spans the amino acid sequence from region 30-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibronectin type III domain containing 6 (FNDC6) (IL-20 receptor subunit beta) (IL-20R-beta) (IL-20RB) (IL-20R2) (DIRS1)

UniProt

Q6UXL0

Expression Region

30-233aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GlycoElute Elution Buffer - BanLec
21511281-2 25 mL

GlycoElute Elution Buffer - BanLec

Sign In for Pricing
View Details
PSMC4 Antibody, HRP conjugated
MBS7052338-01 0.05 mg

PSMC4 Antibody, HRP conjugated

Sign In for Pricing
View Details
PSMC4 Antibody, HRP conjugated
MBS7052338-02 0.1 mg

PSMC4 Antibody, HRP conjugated

Sign In for Pricing
View Details
PSMC4 Antibody, HRP conjugated
MBS7052338-03 5x 0.1 mg

PSMC4 Antibody, HRP conjugated

Sign In for Pricing
View Details
ABCD4 Conjugated Antibody
C34462 100 µL

ABCD4 Conjugated Antibody

Sign In for Pricing
View Details
Cxcl11 Polyclonal Antibody
A54097-020 20 µL

Cxcl11 Polyclonal Antibody

Sign In for Pricing
View Details