Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scrg1 protein

This Mouse Scrg1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein (ScRG-1) ()

UniProt

O88745

Expression Region

21-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD19 Antibody (HB12B)
HB996053-01 1 Each

Anti-Human CD19 Antibody (HB12B)

Sign In for Pricing
View Details
Anti-Human CD19 Antibody (HB12B)
HB996053-02 1 mg

Anti-Human CD19 Antibody (HB12B)

Sign In for Pricing
View Details
Trk A + B + C Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-0192R-PE-Cy5.5 100 µL

Trk A + B + C Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
PPM1B (NM_177969) Human Recombinant Protein
PROTO75688 20 µg

PPM1B (NM_177969) Human Recombinant Protein

Sign In for Pricing
View Details
GART Antibody - N-terminal region
OAGA04659-100UL 100 µL

GART Antibody - N-terminal region

Sign In for Pricing
View Details
ProSeries™ Performance Centrifuge Tubes
C2803 500 Units/Case

ProSeries™ Performance Centrifuge Tubes

Sign In for Pricing
View Details