Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scd1 protein

This Mouse Scd1 protein spans the amino acid sequence from region 260-355aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Delta (9) -desaturase 1 (Delta-9 desaturase 1) (Fatty acid desaturase 1) (Stearoyl-CoA desaturase 1)

UniProt

P13516

Expression Region

260-355aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr15 3'UTR Luciferase Stable Cell Line
TU108987 1.0 mL

Gpr15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DLL4 Recombinant Protein
orb1230209 50 µg

DLL4 Recombinant Protein

Sign In for Pricing
View Details
Mmu-miR-7006-5p agomir
HY-R03747A-01 5 nmol

Mmu-miR-7006-5p agomir

Sign In for Pricing
View Details
Mmu-miR-7006-5p agomir
HY-R03747A-02 20 nmol

Mmu-miR-7006-5p agomir

Sign In for Pricing
View Details
Lentiviral mouse Nup85 shRNA (UAS) - Lentiviral mouse Nup85 shRNA (UAS, iRFP) plasmid
GTR15229132 1 Vial

Lentiviral mouse Nup85 shRNA (UAS) - Lentiviral mouse Nup85 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Chicken L-dopachrome tautomerase (DCT)
orb2902272-01 20 µg

Recombinant Chicken L-dopachrome tautomerase (DCT)

Sign In for Pricing
View Details