Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scd1 protein

This Mouse Scd1 protein spans the amino acid sequence from region 260-355aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Delta (9) -desaturase 1 (Delta-9 desaturase 1) (Fatty acid desaturase 1) (Stearoyl-CoA desaturase 1)

UniProt

P13516

Expression Region

260-355aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (Dimethylamino) -3- (2- (3-methoxyphenethyl) phenoxy) propan-2-ol Hydrochloride
408391-01 100 mg

1- (Dimethylamino) -3- (2- (3-methoxyphenethyl) phenoxy) propan-2-ol Hydrochloride

Sign In for Pricing
View Details
1- (Dimethylamino) -3- (2- (3-methoxyphenethyl) phenoxy) propan-2-ol Hydrochloride
408391-02 250 mg

1- (Dimethylamino) -3- (2- (3-methoxyphenethyl) phenoxy) propan-2-ol Hydrochloride

Sign In for Pricing
View Details
IMMT Antibody
orb519067-01 50 μL

IMMT Antibody

Sign In for Pricing
View Details
IMMT Antibody
orb519067-02 100 µL

IMMT Antibody

Sign In for Pricing
View Details
BC056907 ORF Vector (Human) (pORF)
ORF000947 1.0 µg DNA

BC056907 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human SNRPB2 Protein, N-His
MBS1577384-01 0.1 mg

Recombinant Human SNRPB2 Protein, N-His

Sign In for Pricing
View Details