Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Caveolin 1 protein

This Rat Caveolin 1 protein spans the amino acid sequence from region 2-178aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cav

UniProt

P41350

Expression Region

2-178aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNF1, ID (KCNF1, Potassium voltage-gated channel subfamily F member 1, Voltage-gated potassium channel subunit Kv5.1, kH1) (PE)
MBS6312411-01 0.2 mL

KCNF1, ID (KCNF1, Potassium voltage-gated channel subfamily F member 1, Voltage-gated potassium channel subunit Kv5.1, kH1) (PE)

Sign In for Pricing
View Details
KCNF1, ID (KCNF1, Potassium voltage-gated channel subfamily F member 1, Voltage-gated potassium channel subunit Kv5.1, kH1) (PE)
MBS6312411-02 5x 0.2 mL

KCNF1, ID (KCNF1, Potassium voltage-gated channel subfamily F member 1, Voltage-gated potassium channel subunit Kv5.1, kH1) (PE)

Sign In for Pricing
View Details
SAA4 (CSAA, Serum Amyloid A-4 Protein, Constitutively Expressed Serum Amyloid A Protein, C-SAA) (HRP)
132943-HRP 100 µL

SAA4 (CSAA, Serum Amyloid A-4 Protein, Constitutively Expressed Serum Amyloid A Protein, C-SAA) (HRP)

Sign In for Pricing
View Details
APP/Amyloid beta Human Monoclonal Antibody
orb2977599-01 100 µg

APP/Amyloid beta Human Monoclonal Antibody

Sign In for Pricing
View Details
APP/Amyloid beta Human Monoclonal Antibody
orb2977599-02 1 mg

APP/Amyloid beta Human Monoclonal Antibody

Sign In for Pricing
View Details
3α-Hydroxy-5α-Androst-16-ene
428172-01 100 mg

3α-Hydroxy-5α-Androst-16-ene

Sign In for Pricing
View Details