Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant all1616 protein

This Plant all1616 protein spans the amino acid sequence from region 1-227aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8YWJ7

Expression Region

1-227aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRWVDDSYLLPAAKGLMSTSVPNTYAKLAKALLINYSFDLSGYHVDELVNRWQKQYPADWLHLAVIEALYQGRYKAISVQQLLAFWQRRGQEIYHFNMEFERLICSKFPESLTPMAASEQYSRQGKNQNQTLQLMSFKQQEQVKEEEEPPTEKMLALSSTSVTASIEVSVSQQEDYLGQPFSLNPDISTKLLPISVTHPPIGQFTPQTSDRSESFTSKLKAISNENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXM1 shRNA Plasmid (h)
sc-43769-SH 20 µg

FOXM1 shRNA Plasmid (h)

Sign In for Pricing
View Details
HIST1H3I 3'UTR Luciferase Stable Cell Line
TU009848 1.0 mL

HIST1H3I 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Pigeon Melanin Concentrating Hormone (MCH) ELISA Kit
MBS9348860 Inquire

Pigeon Melanin Concentrating Hormone (MCH) ELISA Kit

Sign In for Pricing
View Details
Human Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) ELISA Kit
EK20768 48 Tests

Human Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) ELISA Kit

Sign In for Pricing
View Details
PDK3 Rabbit Polyclonal Antibody
orb1819440 100 µg

PDK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Splicing Factor 3B Subunit 3 (SF3B3)
MBS2083739-01 0.1 mL

FITC-Linked Polyclonal Antibody to Splicing Factor 3B Subunit 3 (SF3B3)

Sign In for Pricing
View Details