Virus PEP4 protein
This Virus PEP4 protein spans the amino acid sequence from region 77-405aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Aspartate protease (PrA) (Proteinase A) (Carboxypeptidase Y-deficient protein 4) (Proteinase YSCA) (PHO9) (PRA1)
UniProt
P07267
Expression Region
77-405aa
Tag
N-terminal 10xHis-tagged
Source
E.coli
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
39.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15088808 1 Vial
Lentiviral human CREBRF shRNA (UAS) - Lentiviral human CREBRF shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
GTR15300237 1 Vial
Lentiviral mouse Psmb6 shRNA (UAS) - Lentiviral mouse Psmb6 shRNA (UAS) (100)
Sign In for Pricing
View Details 
MBS3809812-01 48 Well
Rat Secreted Frizzled-Related Protein 4 ELISA Kit
Sign In for Pricing
View Details MBS3809812-02 96 Well
Rat Secreted Frizzled-Related Protein 4 ELISA Kit
Sign In for Pricing
View Details MBS3809812-03 5x 96 Well
Rat Secreted Frizzled-Related Protein 4 ELISA Kit
Sign In for Pricing
View Details