Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLHDC3 protein

This Human KLHDC3 protein spans the amino acid sequence from region 1-382aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Peas (Testis intracellular mediator protein) (PEAS)

UniProt

Q9BQ90

Expression Region

1-382aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISRPIVSSHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT-TL1 Protein Vector (Human) (pPM-C-HA)
PV101872 500 ng

MT-TL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Hemoglobin subunit gamma 1 (HBG1) (NM_000559) Human Over-expression Lysate
LH20089V 100 µg

Hemoglobin subunit gamma 1 (HBG1) (NM_000559) Human Over-expression Lysate

Sign In for Pricing
View Details
CASP14 (Caspase-14, CASP-14, Caspase-14) (MaxLight 405)
MBS6445397-01 0.1 mL

CASP14 (Caspase-14, CASP-14, Caspase-14) (MaxLight 405)

Sign In for Pricing
View Details
CASP14 (Caspase-14, CASP-14, Caspase-14) (MaxLight 405)
MBS6445397-02 5x 0.1 mL

CASP14 (Caspase-14, CASP-14, Caspase-14) (MaxLight 405)

Sign In for Pricing
View Details
GAS2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
21317064 1.0 µg DNA

GAS2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Guinea Pig Antithrombin, AT ELISA KIT
E0004Gp-01 48 Well

Guinea Pig Antithrombin, AT ELISA KIT

Sign In for Pricing
View Details