Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile A Intermediate capsid protein VP6 protein

This Reptile A Intermediate capsid protein VP6 protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leuc-A (SVMP)

UniProt

P84907

Expression Region

1-202aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bothrops leucurus (Whitetail lancehead)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QQFSPRYIELVVVADHGMFKKYNSNLNTIRKWVHEMLNTVNGFFRSMNVDASLVNLEVWSKKDLIKVEKDSSKTLTSFGEWRERDLLPRISHDHAQLLTVIFLDEETIGIAYTAGMCDLSQSVAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQCHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (1-20)
4034554.0500 0.5 mg

Histone H3 (1-20)

Sign In for Pricing
View Details
Jchain Mouse siRNA Oligo Duplex (Locus ID 16069)
SR403486 1 Kit

Jchain Mouse siRNA Oligo Duplex (Locus ID 16069)

Sign In for Pricing
View Details
DMAP1 Antibody, Biotin conjugated
A68394-50UG 50 µg

DMAP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Eipr1 Mouse siRNA Oligo Duplex (Locus ID 380752)
SR412975 1 Kit

Eipr1 Mouse siRNA Oligo Duplex (Locus ID 380752)

Sign In for Pricing
View Details
Recombinant Human CD35 Protein, His Tag
KMH190 50 µg

Recombinant Human CD35 Protein, His Tag

Sign In for Pricing
View Details
TOLLIP-set siRNA/shRNA/RNAi Lentivector (Human)
47279091 4x 500 ng

TOLLIP-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details