Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF protein

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycosylation-inhibiting factor (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC, 5.3.3.12) ) (Phenylpyruvate tautomerase) (MIF) (GLIF) (MMIF)

UniProt

P14174

Expression Region

2-115aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tspan31 3'UTR GFP Stable Cell Line
TU272560 1.0 mL

Tspan31 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
OR7E140P CRISPR Knock Out 293T Cell Line (Human)
35578141 1x 10^6 Cells / 1.0 mL

OR7E140P CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
HACL1 siRNA (Human)
MBS8238576-01 15 nmol

HACL1 siRNA (Human)

Sign In for Pricing
View Details
HACL1 siRNA (Human)
MBS8238576-02 30 nmol

HACL1 siRNA (Human)

Sign In for Pricing
View Details
HACL1 siRNA (Human)
MBS8238576-03 5x 30 nmol

HACL1 siRNA (Human)

Sign In for Pricing
View Details
AMPA Receptor 1 (GluA1) Rabbit mAb
C05339-100uL*2 2x 100μL

AMPA Receptor 1 (GluA1) Rabbit mAb

Sign In for Pricing
View Details