Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF protein

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycosylation-inhibiting factor (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC, 5.3.3.12) ) (Phenylpyruvate tautomerase) (MIF) (GLIF) (MMIF)

UniProt

P14174

Expression Region

2-115aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCRL2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
15437066 1.0 µg DNA

CCRL2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ACOT7 Protein Vector (Human) (pPB-His-MBP)
PV319250 500 ng

ACOT7 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
MAGEF1 Antibody - N-terminal region : HRP (ARP62864_P050-HRP)
ARP62864_P050-HRP 100 µL

MAGEF1 Antibody - N-terminal region : HRP (ARP62864_P050-HRP)

Sign In for Pricing
View Details
MAP Kinase 4, NT (Mitogen-activated Protein Kinase 4, MAPK 4, MAPK4, Extracellular Signal-regulated Kinase 4, ERK4, ERK-4, MAP Kinase Isoform p63, p63-MAPK, p63MAPK, PRKM4) (APC) discontinued
M2362-16N-APC 200 µL

MAP Kinase 4, NT (Mitogen-activated Protein Kinase 4, MAPK 4, MAPK4, Extracellular Signal-regulated Kinase 4, ERK4, ERK-4, MAP Kinase Isoform p63, p63-MAPK, p63MAPK, PRKM4) (APC) discontinued

Sign In for Pricing
View Details
Krt39 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3612304 1.0 µg DNA

Krt39 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
TCEA3 Antibody
orb1243572 100 µL

TCEA3 Antibody

Sign In for Pricing
View Details