Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF protein

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycosylation-inhibiting factor (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC, 5.3.3.12) ) (Phenylpyruvate tautomerase) (MIF) (GLIF) (MMIF)

UniProt

P14174

Expression Region

2-115aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kdelr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3516707 1.0 µg DNA

Kdelr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Prg2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37603116 3x 1.0 µg

Prg2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
furan-2-acrylic acid azide
abx187842-01 1 g

furan-2-acrylic acid azide

Sign In for Pricing
View Details
furan-2-acrylic acid azide
abx187842-02 5 g

furan-2-acrylic acid azide

Sign In for Pricing
View Details
IMP2L Antibody (Center)
E45R07993G-1 100 µL

IMP2L Antibody (Center)

Sign In for Pricing
View Details
UQCR10 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
49227154 3x 1.0 µg DNA

UQCR10 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details