Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria mspA protein

This Bacteria mspA protein spans the amino acid sequence from region 28-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MspA, MSMEG_0965, MSMEI_0939, Porin MspA

UniProt

A0QR29

Expression Region

28-211aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycobacterium smegmatis (strain ATCC 700084 / mc (2) 155)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMPRSS13 Antibody Picoband® (Biotine Conjugate)
A10970-1-Biotin 100 µg/Vial

Anti-TMPRSS13 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
ZNF346 3'UTR GFP Stable Cell Line
TU079125 1.0 mL

ZNF346 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PCDHA10 (Protocadherin alpha-10, PCDH-alpha-10, CNRS8, CNR8, CNRN8, CRNR8) (Biotin)
130948-Biotin 100 µL

PCDHA10 (Protocadherin alpha-10, PCDH-alpha-10, CNRS8, CNR8, CNRN8, CRNR8) (Biotin)

Sign In for Pricing
View Details
Recombinant CD33 Antibody
orb2636950 100 µg

Recombinant CD33 Antibody

Sign In for Pricing
View Details
Monkey Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit
MBS7221962-01 48 Well

Monkey Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit

Sign In for Pricing
View Details
Monkey Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit
MBS7221962-02 96 Well

Monkey Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit

Sign In for Pricing
View Details