Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria mspA protein

This Bacteria mspA protein spans the amino acid sequence from region 28-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MspA, MSMEG_0965, MSMEI_0939, Porin MspA

UniProt

A0QR29

Expression Region

28-211aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycobacterium smegmatis (strain ATCC 700084 / mc (2) 155)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTAG1B (Cancer/Testis Antigen 1)
478716 100 µL

CTAG1B (Cancer/Testis Antigen 1)

Sign In for Pricing
View Details
Lentiviral human EPC1 shRNA (UAS) - Lentiviral human EPC1 shRNA (UAS, RFP) plasmid
GTR15094801 1 Vial

Lentiviral human EPC1 shRNA (UAS) - Lentiviral human EPC1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Adgrb1 shRNA (UAS) - Lentiviral mouse Adgrb1 shRNA (UAS, RFP) plasmid
GTR15242833 1 Vial

Lentiviral mouse Adgrb1 shRNA (UAS) - Lentiviral mouse Adgrb1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
PIK3C2A Antibody
orb1332345 100 µg

PIK3C2A Antibody

Sign In for Pricing
View Details
ESR1 isoform1, CT (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1)
035233 200 µL

ESR1 isoform1, CT (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1)

Sign In for Pricing
View Details
KCTD9 Rabbit Monoclonal Antibody
AMRe21218-01 50 µL

KCTD9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details