Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria mspA protein

This Bacteria mspA protein spans the amino acid sequence from region 28-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MspA, MSMEG_0965, MSMEI_0939, Porin MspA

UniProt

A0QR29

Expression Region

28-211aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycobacterium smegmatis (strain ATCC 700084 / mc (2) 155)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DPB1 Rabbit Polyclonal Antibody (APC)
orb1007320 100 µL

HLA-DPB1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Tau (Tau Protein, Microtubule-associated Protein, MAP) discontinued
T1032-68A 40 µg

Tau (Tau Protein, Microtubule-associated Protein, MAP) discontinued

Sign In for Pricing
View Details
Research Grade Anti-Human LGALS9 (HFB200902)
HT173026-01 100 µg

Research Grade Anti-Human LGALS9 (HFB200902)

Sign In for Pricing
View Details
Research Grade Anti-Human LGALS9 (HFB200902)
HT173026-02 1 mg

Research Grade Anti-Human LGALS9 (HFB200902)

Sign In for Pricing
View Details
Rno-miR-3557-3p miRNA Mimic
orb1873672-01 5 nmol

Rno-miR-3557-3p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-3557-3p miRNA Mimic
orb1873672-02 10 nmol

Rno-miR-3557-3p miRNA Mimic

Sign In for Pricing
View Details