Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C8G protein

This Human C8G protein spans the amino acid sequence from region 21-202aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C8C, C8G, CO8G_HUMAN, Complement component 8 gamma polypeptide, Complement component C8 gamma chain, MGC142186

UniProt

P07360

Expression Region

21-202aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpx2 (Glutathione Peroxidase 2) BioAssayTM ELISA Kit (Rat) discontinued
519272 96 Tests

Gpx2 (Glutathione Peroxidase 2) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
C11orf42 siRNA (Human)
MBS8219982-01 15 nmol

C11orf42 siRNA (Human)

Sign In for Pricing
View Details
C11orf42 siRNA (Human)
MBS8219982-02 30 nmol

C11orf42 siRNA (Human)

Sign In for Pricing
View Details
C11orf42 siRNA (Human)
MBS8219982-03 5x 30 nmol

C11orf42 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila ihfA Protein (aa 1-97) (strain Lens)
VAng-Lsx04370-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila ihfA Protein (aa 1-97) (strain Lens)

Sign In for Pricing
View Details
Mouse Monoclonal Mucin 5AC Antibody (MUC5AC/917 + 45M1) [PerCP]
NBP2-47696PCP 0.1 mL

Mouse Monoclonal Mucin 5AC Antibody (MUC5AC/917 + 45M1) [PerCP]

Sign In for Pricing
View Details