Insect Bothrops leucurus Snake venom metalloproteinase leucurolysin-A protein
This Insect Bothrops leucurus Snake venom metalloproteinase leucurolysin-A protein spans the amino acid sequence from region 27-306aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Dermonecrotic toxin 1 (LiRecDT1) (Sphingomyelin phosphodiesterase D 1) (SMD 1) (SMase D 1) (Sphingomyelinase D 1) (PLD)
UniProt
P0CE80
Expression Region
27-306aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Loxosceles intermedia (Brown spider)
Field of Research
Musculoskeletal & Connective Tissue Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
38.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AGNRRPIWIMGHMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSKYQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDKVGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGVDGIMTNYPDVITDVLNEAAYKKKFRVATYDENPWVTFKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680525-100 1x 100 µL
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472848-500 1x 500 µL
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470525-100 1x 100 µL
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400813-500 1x 500 µL
CD74 (CLIP/813), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details