Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf20 protein

This Mouse Fgf20 protein spans the amino acid sequence from region 1-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-20

UniProt

Q9ESL9

Expression Region

1-211aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Dnmt1 Antibody Picoband® (iFluor647 Conjugate)
A00172-1-iFluor647 100 µg

Anti-Dnmt1 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Phospho-mTOR (Thr2446) Rabbit pAb
orb2715587-01 20 ul

Phospho-mTOR (Thr2446) Rabbit pAb

Sign In for Pricing
View Details
Phospho-mTOR (Thr2446) Rabbit pAb
orb2715587-02 50 µL

Phospho-mTOR (Thr2446) Rabbit pAb

Sign In for Pricing
View Details
Phospho-mTOR (Thr2446) Rabbit pAb
orb2715587-03 100 µL

Phospho-mTOR (Thr2446) Rabbit pAb

Sign In for Pricing
View Details
TCEB3 (Transcription Elongation Factor B (SIII), Polypeptide 3 (110kD, elongin A), FLJ38760, FLJ42849, SIII, TCEB3A) (HRP)
252467-HRP 100 µL

TCEB3 (Transcription Elongation Factor B (SIII), Polypeptide 3 (110kD, elongin A), FLJ38760, FLJ42849, SIII, TCEB3A) (HRP)

Sign In for Pricing
View Details
ANP32B Human Pre-designed siRNA Set A
HY-RS00752 1 Set

ANP32B Human Pre-designed siRNA Set A

Sign In for Pricing
View Details