Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HAPLN2 protein

This Human HAPLN2 protein spans the amino acid sequence from region 27-340aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain link protein 1 (BRAL1)

UniProt

Q9GZV7

Expression Region

27-340aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PVALB (Parvalbumin) ELISA Kit
MBS8803148-01 48 Well

Human PVALB (Parvalbumin) ELISA Kit

Sign In for Pricing
View Details
Human PVALB (Parvalbumin) ELISA Kit
MBS8803148-02 96 Well

Human PVALB (Parvalbumin) ELISA Kit

Sign In for Pricing
View Details
Human PVALB (Parvalbumin) ELISA Kit
MBS8803148-03 5x 96 Well

Human PVALB (Parvalbumin) ELISA Kit

Sign In for Pricing
View Details
Human PVALB (Parvalbumin) ELISA Kit
MBS8803148-04 10x 96 Well

Human PVALB (Parvalbumin) ELISA Kit

Sign In for Pricing
View Details
SH3 Domain Binding Glutamic Acid-Rich Protein Like 3 Human Recombinant
rAP-4784 1 Each

SH3 Domain Binding Glutamic Acid-Rich Protein Like 3 Human Recombinant

Sign In for Pricing
View Details
Kallikrein 11 (Kallikrein 11) Antibody
abx007794-01 30 µL

Kallikrein 11 (Kallikrein 11) Antibody

Sign In for Pricing
View Details