Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Zea mays Endochitinase B protein

This Virus Zea mays Endochitinase B protein spans the amino acid sequence from region 1-249aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hemagglutinin

UniProt

A9Q1L0

Expression Region

1-249aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS641913 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-1102
BCBS-1102 1 Unit

Biological Safety Cabinet Class II BCBS-1102

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF647 conjugate, 0.1mg/mL
BNC472470-500 1x 500 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(-)-Estra-4,9-diene-3,17-dione
TRC-E668550-1G 1 g

(-)-Estra-4,9-diene-3,17-dione

Sign In for Pricing
View Details
TissueScan, Lymphoma cDNA Array I
LYRT101 2 Panels

TissueScan, Lymphoma cDNA Array I

Sign In for Pricing
View Details
Anti Human RAB6A Polyclonal
Y054335 100 µL

Anti Human RAB6A Polyclonal

Sign In for Pricing
View Details