Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Hpse protein

This Rat Hpse protein spans the amino acid sequence from region 29-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endo-glucoronidase (Hep)

UniProt

Q71RP1

Expression Region

29-102aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT5 Rabbit Polyclonal Antibody (APC)
orb2595153 100 µg

PRMT5 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Lentiviral mouse Akr1b10 shRNA (UAS) - Lentiviral mouse Akr1b10 shRNA (UAS, RFP) (100)
GTR15187788 1 Vial

Lentiviral mouse Akr1b10 shRNA (UAS) - Lentiviral mouse Akr1b10 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
IgM, Fc5 mu Fragment, 4nm (Gold) discontinued
216070 1 mL

IgM, Fc5 mu Fragment, 4nm (Gold) discontinued

Sign In for Pricing
View Details
VWA5A antibody
MBS832482-01 0.1 mL

VWA5A antibody

Sign In for Pricing
View Details
VWA5A antibody
MBS832482-02 5x 0.1 mL

VWA5A antibody

Sign In for Pricing
View Details
Human GAD1 ELISA Kit
orb562858-01 48 Tests

Human GAD1 ELISA Kit

Sign In for Pricing
View Details