Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish X Outer capsid protein VP4 protein

This Fish X Outer capsid protein VP4 protein spans the amino acid sequence from region 36-214aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Equinatoxin II (DELTA-AITX-Aeq1a) (EqT II) (EqTII) (Equinatoxin-2)

UniProt

P61914

Expression Region

36-214aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Actinia equina (Beadlet anemone)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SADVAGAVIDGASLSFDILKTVLEALGNVKRKIAVGVDNESGKTWTALNTYFRSGTSDIVLPHKVPHGKALLYNGQKDRGPVATGAVGVLAYLMSDGNTLAVLFSVPYDYNWYSNWWNVRIYKGKRRADQRMYEELYYNLSPFRGDNGWHTRNLGYGLKSRGFMNSSGHAILEIHVSKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VPREB3 activation kit by CRISPRa
GA109276 1 Kit

Human VPREB3 activation kit by CRISPRa

Sign In for Pricing
View Details
STX7 Antibody
KC-7609-01 50 μL

STX7 Antibody

Sign In for Pricing
View Details
STX7 Antibody
KC-7609-02 100 µL

STX7 Antibody

Sign In for Pricing
View Details
STX7 Antibody
KC-7609-03 1 mL

STX7 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097UD-01 25 µg

PE Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
PE Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097UD-02 100 µg

PE Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details