Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRTN3 protein

This Human PRTN3 protein spans the amino acid sequence from region 28-248aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AGP7 (C-ANCA antigen) (Leukocyte proteinase 3) (PR-3) (PR3) (Neutrophil proteinase 4) (NP-4) (P29) (Wegener autoantigen) (MBN)

UniProt

P24158

Expression Region

28-248aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LRRC9 Protein
E30P68568A 50 µg

Recombinant Human LRRC9 Protein

Sign In for Pricing
View Details
REA Recombinant Rabbit mAb
orb2326821-01 25 µL

REA Recombinant Rabbit mAb

Sign In for Pricing
View Details
REA Recombinant Rabbit mAb
orb2326821-02 50 µL

REA Recombinant Rabbit mAb

Sign In for Pricing
View Details
REA Recombinant Rabbit mAb
orb2326821-03 100 µL

REA Recombinant Rabbit mAb

Sign In for Pricing
View Details
Human MKRN2 shRNA Plasmid
abx958395-01 150 µg

Human MKRN2 shRNA Plasmid

Sign In for Pricing
View Details
Human MKRN2 shRNA Plasmid
abx958395-02 300 µg

Human MKRN2 shRNA Plasmid

Sign In for Pricing
View Details