Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRTN3 protein

This Human PRTN3 protein spans the amino acid sequence from region 28-248aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AGP7 (C-ANCA antigen) (Leukocyte proteinase 3) (PR-3) (PR3) (Neutrophil proteinase 4) (NP-4) (P29) (Wegener autoantigen) (MBN)

UniProt

P24158

Expression Region

28-248aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain UTI89/UPEC) MDTC Polyclonal Antibody
MBS7191777 Inquire

Rabbit anti-Escherichia coli (strain UTI89/UPEC) MDTC Polyclonal Antibody

Sign In for Pricing
View Details
4-Hydroxy-3-nitrobiphenyl
sc-261995A 50 g

4-Hydroxy-3-nitrobiphenyl

Sign In for Pricing
View Details
Magic™ Membrane Protein Human AFG3L2 (AFG3 like matrix AAA peptidase subunit 2) Full Length
MPC3527K Each

Magic™ Membrane Protein Human AFG3L2 (AFG3 like matrix AAA peptidase subunit 2) Full Length

Sign In for Pricing
View Details
CRISP-2 Double Nickase Plasmid (m)
sc-423488-NIC 20 µg

CRISP-2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
[6- (Trifluoromethyl) -1H-1,3-benzodiazol-2-yl]methanamine
UMB90389-01 50 mg

[6- (Trifluoromethyl) -1H-1,3-benzodiazol-2-yl]methanamine

Sign In for Pricing
View Details
[6- (Trifluoromethyl) -1H-1,3-benzodiazol-2-yl]methanamine
UMB90389-02 0.5 g

[6- (Trifluoromethyl) -1H-1,3-benzodiazol-2-yl]methanamine

Sign In for Pricing
View Details