Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PRKAG1 protein

This Mouse PRKAG1 protein spans the amino acid sequence from region 1-330aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AMPK gamma1 (AMPK subunit gamma-1) (AMPKg) (Prkaac)

UniProt

O54950

Expression Region

1-330aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TRIM2 shRNA (UAS) - Lentiviral human TRIM2 shRNA (UAS, RFP) (25)
GTR15118763 1 Vial

Lentiviral human TRIM2 shRNA (UAS) - Lentiviral human TRIM2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Gm884 CRISPR Activation Plasmid (m2)
sc-436206-ACT-2 20 µg

Gm884 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
CD71 CRISPR Activation Plasmid (h2)
sc-400310-ACT-2 20 µg

CD71 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
GORASP2, ID (GORASP2, GOLPH6, Golgi reassembly-stacking protein 2, Golgi phosphoprotein 6, Golgi reassembly-stacking protein of 55kD, p59) (PE) discontinued
036175-PE 200 µL

GORASP2, ID (GORASP2, GOLPH6, Golgi reassembly-stacking protein 2, Golgi phosphoprotein 6, Golgi reassembly-stacking protein of 55kD, p59) (PE) discontinued

Sign In for Pricing
View Details
MEP1A/Meprin alpha Polyclonal Antibody, APC Conjugated
bs-6056R-APC 100 µL

MEP1A/Meprin alpha Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Porcine progesterone (PROG) ELISA kit
MBS261091-01 48 Well

Porcine progesterone (PROG) ELISA kit

Sign In for Pricing
View Details